PPIRE00186
Target Protein Information
| Protein_Name | Melanocortin receptor 3 |
|---|---|
| Protein_Sequence | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | MC3R |
| UniProt_ID | P41968 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | (Nle4,D-Phe7)-aMSH [NDPaMSH] |
|---|---|
| Peptide_Sequence | SYSXEHfRWGKPV |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CO)C(=O)O |
| Chemical_Modification | X4=Norleucine, f=D-Phenylalanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1549.71 |
|---|---|
| Aliphatic_Index | 22.30769 |
| Aromaticity | 0.23077 |
| Average_Rotatable_Bonds | 3.53846 |
| Charge_at_pH_7 | 1.08952 |
| Isoelectric_Point | 9.29976 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 634.11000 |
| X_logP_energy | -5.23663 |
Interaction Information
| Affinity | IC50=6.17 nM |
|---|---|
| Affinity_Assay | Ligand competition binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Potent and selective agonists of alpha-melanotropin (alphaMSH)action at human melanocortin receptor 5; linear analogs of alpha-melanotropin. |
| Release_Year | 2007 |
| PMID | 17376561 |
| DOI | 10.1016/j.peptides.2007.02.011 |