PPIRE00751
Target Protein Information
| Protein_Name | Myoglobin |
|---|---|
| Protein_Sequence | MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG |
| Organism_Source | Equus caballus |
| Functional_Classification | globins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MB |
| UniProt_ID | P68082 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MP-8 |
|---|---|
| Peptide_Sequence | EVKFLGDI |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CCC(=O)O)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 920.07 |
|---|---|
| Aliphatic_Index | 133.75000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.87500 |
| Charge_at_pH_7 | -1.00009 |
| Isoelectric_Point | 4.18441 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 367.64000 |
| X_logP_energy | -1.11730 |
Interaction Information
| Affinity | KD=2.7 uM |
|---|---|
| Affinity_Assay | spectrophotometric titration |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Haem peptide-protein interactions. Part 2. 閳 Kinetics and mechanism of the interaction of microperoxides-8 with apomyoglobin |
| Release_Year | 1989 |
| PMID | None |
| DOI | 10.1039/f19898503845 |