PPIRE00822
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | ENSRIFFGCLLLLLILLLLFVFLISPEISPDFMRGFVTVNSSKLELLISVGLFLILIGLVIEAYLEEQRINTQLLNNLTIYTEKIESINEELAMFRHDYKNLLYSLQIAISYEDILEIKRIYEETIAPTKKIIDNEEFELMKLNRLKNMELKALISMKINTAKQAKLKVIVDVPEVFIL |
| Organism_Source | Enterococcus faecalis |
| Functional_Classification | histidine kinase |
| Cellular_Localization | plasma membrane |
| Gene_Names | fsrC |
| UniProt_ID | A0A248QKI7 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | [Ala5-9-11]Z-GBAP |
|---|---|
| Peptide_Sequence | IRSPAIFGAWA |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](C)C(=O)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | Main chain-side chain cyclization; S3<->A11; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Benzyloxycarbonyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1188.39 |
|---|---|
| Aliphatic_Index | 98.18182 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 14 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 443.45000 |
| X_logP_energy | -2.24193 |
Interaction Information
| Affinity | IC50=8.7 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development of a peptide antagonist against fsr quorum sensing of Enterococcus faecalis. |
| Release_Year | 2013 |
| PMID | 23362999 |
| DOI | 10.1021/cb300717f |