PPIRE00845
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MEPVDPRLEPWNHPGSQPKTACNNCYCKRCCYHCLYCFTKKGLGISYGRKKRSQRRRTPQSSKSHQDLIPEQPLSQQQGDQTGQKKQKEALESKTEADPCD |
| Organism_Source | Human immunodeficiency virus type 1 group N (isolate YBF30) |
| Functional_Classification | RNA-binding element |
| Cellular_Localization | nucleus |
| Gene_Names | tat |
| UniProt_ID | O91083 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Tat-18 |
|---|---|
| Peptide_Sequence | YGRKKRRQRRRPPQGPGG |
| Peptide_Length | 18 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2150.48 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.05556 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 7.99652 |
| Isoelectric_Point | 12.80804 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 30 |
| Number_of_Hydrogen_Bond_Donors | 39 |
| Topological_Polar_Surface_Area | 1061.50000 |
| X_logP_energy | -13.99898 |
Interaction Information
| Affinity | KD=0.87 mM |
|---|---|
| Affinity_Assay | 1H NMR spectroscopy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Kinetic characterization of TAR RNA-Tat peptide and neomycin interactions by acoustic wave biosensor. |
| Release_Year | 2003 |
| PMID | 14556896 |
| DOI | 10.1016/S0301-4622(03)00155-8 |