PPIRE00886
Target Protein Information
| Protein_Name | Kallikrein-5 |
|---|---|
| Protein_Sequence | MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine proteases |
| Cellular_Localization | extracellular |
| Gene_Names | KLK5 |
| UniProt_ID | Q9Y337 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Analogue 6 |
|---|---|
| Peptide_Sequence | GRCTRSIPPHCWPD |
| Peptide_Length | 14 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CN)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Multi-point cyclization; G1<->D14; amide bond; C3<->C11; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1624.86 |
|---|---|
| Aliphatic_Index | 27.85714 |
| Aromaticity | 0.07143 |
| Average_Rotatable_Bonds | 3.14286 |
| Charge_at_pH_7 | 0.96538 |
| Isoelectric_Point | 8.24295 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 661.28000 |
| X_logP_energy | -7.17946 |
Interaction Information
| Affinity | KD=20 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Bioactive peptides from Atlantic salmon (Salmo salar)with angiotensin converting enzyme and dipeptidyl peptidase IV inhibitory, and antioxidant activities. |
| Release_Year | 2016 |
| PMID | 27719926 |
| DOI | 10.1016/j.foodchem.2016.09.053 |