PPIRE00968
Target Protein Information
| Protein_Name | Tubulin beta chain |
|---|---|
| Protein_Sequence | FWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA |
| Organism_Source | Bos indicus x Bos taurus |
| Functional_Classification | tubulins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TUBB |
| UniProt_ID | A0A4W2DVZ1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Dolastatin 10 |
|---|---|
| Peptide_Sequence | XVXXX |
| Peptide_Length | 5 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CN)C(=O)NCC(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 345.36 |
|---|---|
| Aliphatic_Index | 58.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 6 |
| Number_of_Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 179.72000 |
| X_logP_energy | -3.48090 |
Interaction Information
| Affinity | IC50=1.2 uM |
|---|---|
| Affinity_Assay | turbidimetric polymerization assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure-activity studies with chiral isomers and with segments of the antimitotic marine peptide dolastatin 10. |
| Release_Year | 1990 |
| PMID | 2242019 |
| DOI | 10.1016/0006-2952(90)90367-t |