PPIRE01057
Target Protein Information
| Protein_Name | Chymase |
|---|---|
| Protein_Sequence | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine proteases |
| Cellular_Localization | extracellular |
| Gene_Names | CMA1 |
| UniProt_ID | P23946 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 4C-A4 |
|---|---|
| Peptide_Sequence | NATRWTDWTTAN |
| Peptide_Length | 12 |
| Peptide_SMILES | C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(N)=O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1436.50 |
|---|---|
| Aliphatic_Index | 16.66667 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.41667 |
| Charge_at_pH_7 | -0.00157 |
| Isoelectric_Point | 6.33872 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 681.30000 |
| X_logP_energy | -8.76913 |
Interaction Information
| Affinity | KD=1.1 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 4AFQ |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Generation, characterization and structural data of chymase binding proteins based on the human Fyn kinase SH3 domain. |
| Release_Year | 2012 |
| PMID | 22653218 |
| DOI | 10.4161/mabs.20452 |