PPIRE01183
Target Protein Information
| Protein_Name | Stage II sporulation protein SA |
|---|---|
| Protein_Sequence | MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAFIFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASLCHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVLPIEEEGEG |
| Organism_Source | Bacillus subtilis (strain 168) |
| Functional_Classification | membrane-acting toxin |
| Cellular_Localization | plasma membrane |
| Gene_Names | spoIISA |
| UniProt_ID | O34853 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SpoIISB |
|---|---|
| Peptide_Sequence | MGADHNSKSDAEKIHDSVRRIYGRKMAELIQFLKDANRLEAYLESGK |
| Peptide_Length | 47 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CCSC)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 5393.10 |
|---|---|
| Aliphatic_Index | 74.89362 |
| Aromaticity | 0.06383 |
| Average_Rotatable_Bonds | 4.06383 |
| Charge_at_pH_7 | 1.18550 |
| Isoelectric_Point | 9.06500 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 78 |
| Number_of_Hydrogen_Bond_Donors | 84 |
| Topological_Polar_Surface_Area | 2386.03000 |
| X_logP_energy | -24.70982 |
Interaction Information
| Affinity | KD=4.6 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 3O6Q |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis. |
| Release_Year | 2011 |
| PMID | 21147767 |
| DOI | 10.1074/jbc.M110.172429 |