PPIRE01242
Target Protein Information
| Protein_Name | Chromobox protein homolog 7 |
|---|---|
| Protein_Sequence | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromodomains |
| Cellular_Localization | nucleus |
| Gene_Names | CBX7 |
| UniProt_ID | O95931 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Consensus RGFALKme3STHG |
|---|---|
| Peptide_Sequence | RGFALXSTHG |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](N)CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)O)[C@@H](C)O |
| Chemical_Modification | X6=trimethyllysine |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1002.10 |
|---|---|
| Aliphatic_Index | 49.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.10000 |
| Charge_at_pH_7 | 1.08889 |
| Isoelectric_Point | 10.55176 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 456.26000 |
| X_logP_energy | -6.43343 |
Interaction Information
| Affinity | KD=5 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2L12 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1. |
| Release_Year | 2016 |
| PMID | 26807715 |
| DOI | 10.1038/nchembio.2007 |