PPIRE01254
Target Protein Information
| Protein_Name | Chromobox protein homolog 1 |
|---|---|
| Protein_Sequence | MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN |
| Organism_Source | Mus musculus |
| Functional_Classification | chromodomain |
| Cellular_Localization | nucleus |
| Gene_Names | Cbx1 |
| UniProt_ID | P83917 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Histone H3(1-18)K4me3K9me3 peptide |
|---|---|
| Peptide_Sequence | ARTXQTARXSTGGKAPGG |
| Peptide_Length | 18 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)NCC(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X4=N,N-diethyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1629.75 |
|---|---|
| Aliphatic_Index | 16.66667 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.94444 |
| Charge_at_pH_7 | 2.99768 |
| Isoelectric_Point | 12.51648 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 27 |
| Number_of_Hydrogen_Bond_Donors | 30 |
| Topological_Polar_Surface_Area | 823.06000 |
| X_logP_energy | -15.95006 |
Interaction Information
| Affinity | KD=1.94 mM |
|---|---|
| Affinity_Assay | intrinsic tryptophan fluorescence |
| PDB_ID | 1GUW |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of the HP1 chromodomain bound to histone H3 methylated at lysine 9. |
| Release_Year | 2002 |
| PMID | 11882902 |
| DOI | 10.1038/nature722 |