PPIRE01281
Target Protein Information
| Protein_Name | Calmodulin |
|---|---|
| Protein_Sequence | MKQECNVCYFNLPDPESTLGPYDNELNYFTWGPGFEYEPEPQRKPLSIEESFENSEESEESVADIQQLEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYGDNLTYEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQEAIDALNAFSSEDNIDYKLFCEDILQ |
| Organism_Source | Plasmodium falciparum (isolate 3D7) |
| Functional_Classification | Adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | None |
| UniProt_ID | Q8I4W8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pAla[807-811] myoA peptide |
|---|---|
| Peptide_Sequence | ETIVVLXDISXELNPL |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)O)[C@@H](C)CC)C(C)C)C(C)C)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | X6=(S)-pentenyl alanine; X10=(S)-pentenyl alanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1668.90 |
|---|---|
| Aliphatic_Index | 158.12500 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.37500 |
| Charge_at_pH_7 | -2.99802 |
| Isoelectric_Point | 3.42471 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 686.48000 |
| X_logP_energy | -5.56540 |
Interaction Information
| Affinity | IC50=10 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 4MZK |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structures of stapled and hydrogen bond surrogate peptides targeting a fully buried protein-helix interaction. |
| Release_Year | 2014 |
| PMID | 25084543 |
| DOI | 10.1021/cb500271c |