PPIRE01304
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 1 |
|---|---|
| Protein_Sequence | ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA |
| Organism_Source | Homo sapiens |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | extracellular |
| Gene_Names | IGHG1 |
| UniProt_ID | P01857 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LH1 |
|---|---|
| Peptide_Sequence | FNMXQQRRFYXALH |
| Peptide_Length | 14 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)Cc1ccccc1)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O |
| Chemical_Modification | X4=Fmoc-glutamic acid O-(5-allyloxycarbonyl-1-5-diaminopentane); X11=Fmoc-glutamic acid O-allyl ester |
| Cyclization_Method | Side chain-side chain cyclization; X4<->X11; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Succinyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1724.96 |
|---|---|
| Aliphatic_Index | 35.00000 |
| Aromaticity | 0.21429 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 2.08804 |
| Isoelectric_Point | 11.14768 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 743.60000 |
| X_logP_energy | -6.88496 |
Interaction Information
| Affinity | KD=1 mM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 5U66 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | 3-2-1: Structural insights from stepwise shrinkage of a three-helix Fc-binding domain to a single helix. |
| Release_Year | 2017 |
| PMID | 28475752 |
| DOI | 10.1093/protein/gzx029 |