PPIRE01315
Target Protein Information
| Protein_Name | Microtubule-associated protein 1 light chain 3 beta |
|---|---|
| Protein_Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAP1LC3B |
| UniProt_ID | Q9GZQ8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p62-LIR |
|---|---|
| Peptide_Sequence | DDDWTHLS |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CC(=O)O)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 987.98 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | -2.90977 |
| Isoelectric_Point | 3.82517 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 463.85000 |
| X_logP_energy | -4.67500 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Characterization of the interaction of GABARAPL-1 with the LIR motif of NBR1. |
| Release_Year | 2011 |
| PMID | 21620860 |
| DOI | 10.1016/j.jmb.2011.05.003 |