PPIRE01335
Target Protein Information
| Protein_Name | Matrilysin |
|---|---|
| Protein_Sequence | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK |
| Organism_Source | Homo sapiens |
| Functional_Classification | matrix metalloproteinases |
| Cellular_Localization | extracellular |
| Gene_Names | MMP7 |
| UniProt_ID | P09237 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | actinonin |
|---|---|
| Peptide_Sequence | XXX |
| Peptide_Length | 3 |
| Peptide_SMILES | NCC(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | X1=hydroxamic acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 189.17 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.66667 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 4 |
| Number_of_Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 121.52000 |
| X_logP_energy | -2.73790 |
Interaction Information
| Affinity | IC50=2.1 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | 4Q4E |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for the inhibition of M1 family aminopeptidases by the natural product actinonin: Crystal structure in complex with E. coli aminopeptidase N. |
| Release_Year | 2015 |
| PMID | 25644575 |
| DOI | 10.1002/pro.2653 |