PPIRE01535
Target Protein Information
| Protein_Name | H-2 class II histocompatibility antigen, I-A beta chain |
|---|---|
| Protein_Sequence | MVWLPRVPCVAAVILLLTVLSPPVALVRDSRPWFLEYCKSECHFYNGTQRVRFLKRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEILDEKRAAVDTYCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEWKAQSTSAQNKMLSGVGGFVLGLLFLRAGLFIYFRNQKGQSGLQPTGLLS |
| Organism_Source | Mus musculus |
| Functional_Classification | Immune-related protein |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-Eb1 |
| UniProt_ID | P18468 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MCC-p5E |
|---|---|
| Peptide_Sequence | MANERADLIAYLEQATK |
| Peptide_Length | 17 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1937.20 |
|---|---|
| Aliphatic_Index | 92.35294 |
| Aromaticity | 0.05882 |
| Average_Rotatable_Bonds | 3.88235 |
| Charge_at_pH_7 | -0.99917 |
| Isoelectric_Point | 4.42641 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 28 |
| Number_of_Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 855.38000 |
| X_logP_energy | -7.80733 |
Interaction Information
| Affinity | KD=500 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 3QIW |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k). |
| Release_Year | 2011 |
| PMID | 21490152 |
| DOI | 10.4049/jimmunol.1100197 |