PPIRE01685
Target Protein Information
| Protein_Name | Folate receptor alpha |
|---|---|
| Protein_Sequence | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | Receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | FOLR1 |
| UniProt_ID | P15328 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | DSEZKAY |
|---|---|
| Peptide_Sequence | DSEXKAY |
| Peptide_Length | 7 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | Z4=AzPhe-folate |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 768.78 |
|---|---|
| Aliphatic_Index | 14.28571 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.57143 |
| Charge_at_pH_7 | -1.00094 |
| Isoelectric_Point | 4.18441 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 13 |
| Number_of_Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 379.00000 |
| X_logP_energy | -4.63250 |
Interaction Information
| Affinity | KD=0.24 nM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Enhancement of Binding Affinity of Folate to Its Receptor by Peptide Conjugation. |
| Release_Year | 2019 |
| PMID | 31052315 |
| DOI | 10.3390/ijms20092152 |