PPIRE01768
Target Protein Information
| Protein_Name | CD81 antigen |
|---|---|
| Protein_Sequence | MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY |
| Organism_Source | Homo sapiens |
| Functional_Classification | receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CD81 |
| UniProt_ID | P60033 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P152 |
|---|---|
| Peptide_Sequence | CFMKRLRK |
| Peptide_Length | 8 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1081.41 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 4.87500 |
| Charge_at_pH_7 | 3.93541 |
| Isoelectric_Point | 11.65159 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 442.86000 |
| X_logP_energy | -2.45186 |
Interaction Information
| Affinity | KD=0.91 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Screening of EWI-2-Derived Peptides for Targeting Tetraspanin CD81 and Their Effect on Cancer Cell Migration. |
| Release_Year | 2023 |
| PMID | 36979448 |
| DOI | 10.3390/biom13030510 |