PPIRE01879
Target Protein Information
| Protein_Name | Anterior gradient protein 2 homolog |
|---|---|
| Protein_Sequence | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL |
| Organism_Source | Homo sapiens |
| Functional_Classification | Enzyme |
| Cellular_Localization | Extracellular |
| Gene_Names | AGR2 |
| UniProt_ID | O95994 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H10 |
|---|---|
| Peptide_Sequence | MKMQVRIYLV |
| Peptide_Length | 10 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCSC)C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1280.65 |
|---|---|
| Aliphatic_Index | 136.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 4.40000 |
| Charge_at_pH_7 | 1.99684 |
| Isoelectric_Point | 10.45492 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 476.46000 |
| X_logP_energy | -0.72203 |
Interaction Information
| Affinity | IC50=9 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification, characterization and application of a new peptide against anterior gradient homolog 2 (AGR2). |
| Release_Year | 2018 |
| PMID | 29937991 |
| DOI | 10.18632/oncotarget.25221 |