PPIRE01916
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 1 |
|---|---|
| Protein_Sequence | ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA |
| Organism_Source | Homo sapiens |
| Functional_Classification | Immune-related protein |
| Cellular_Localization | Extracellular |
| Gene_Names | IGHG1 |
| UniProt_ID | P01857 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | biotinylated DAE10 peptide |
|---|---|
| Peptide_Sequence | DAEFRHDSGY |
| Peptide_Length | 10 |
| Peptide_SMILES | C[C@H](NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | other |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1196.20 |
|---|---|
| Aliphatic_Index | 10.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.70000 |
| Charge_at_pH_7 | -1.90929 |
| Isoelectric_Point | 4.36607 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 568.16000 |
| X_logP_energy | -6.36063 |
Interaction Information
| Affinity | KD=1.8 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure reveals conservation of amyloid-Beta conformation recognized by 3D6 following humanization to bapineuzumab. |
| Release_Year | 2014 |
| PMID | 25024748 |
| DOI | 10.1186/alzrt261 |