PPIRE01967
Target Protein Information
| Protein_Name | von Hippel-Lindau disease tumor suppressor |
|---|---|
| Protein_Sequence | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
| Organism_Source | Homo sapiens |
| Functional_Classification | Enzyme |
| Cellular_Localization | Cytoplasm |
| Gene_Names | VHL |
| UniProt_ID | P40337 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HIF-1a N-segment peptide |
|---|---|
| Peptide_Sequence | MLAXYI |
| Peptide_Length | 6 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(=O)O |
| Chemical_Modification | X4=4-hydroxyproline |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 666.83 |
|---|---|
| Aliphatic_Index | 146.66667 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.33333 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 9 |
| Number_of_Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 229.05000 |
| X_logP_energy | 0.26720 |
Interaction Information
| Affinity | KD=0.61 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Lymphatic metastasis in the absence of functional intratumor lymphatics. |
| Release_Year | 2002 |
| PMID | 11976409 |
| DOI | 10.1126/science.1071420 |