PPIRE02029
Target Protein Information
| Protein_Name | SaV-like |
|---|---|
| Protein_Sequence | MEDMVDHPPHYNQAGVECIDAIEAALGAENFEFYLQGNVMKYLWRYRYKNGVEDLQKAKWYLEKLIDSTYSP |
| Organism_Source | uncultured virus |
| Functional_Classification | other |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | A0A0A0UXU9 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SBP-Tag |
|---|---|
| Peptide_Sequence | MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP |
| Peptide_Length | 38 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)NCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@H]1C(=O)O)C(C)C)C(C)C)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4305.76 |
|---|---|
| Aliphatic_Index | 61.57895 |
| Aromaticity | 0.02632 |
| Average_Rotatable_Bonds | 3.81579 |
| Charge_at_pH_7 | -1.71850 |
| Isoelectric_Point | 6.22922 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 60 |
| Number_of_Hydrogen_Bond_Donors | 66 |
| Topological_Polar_Surface_Area | 1928.72000 |
| X_logP_energy | -20.54892 |
Interaction Information
| Affinity | KD=4.9 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 4JO6 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The structure of the SBP-Tag-streptavidin complex reveals a novel helical scaffold bridging binding pockets on separate subunits. |
| Release_Year | 2013 |
| PMID | 23633599 |
| DOI | 10.1107/S0907444913002576 |