PPIRE02122
Target Protein Information
| Protein_Name | Troponin C, slow skeletal and cardiac muscles |
|---|---|
| Protein_Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TNNC1 |
| UniProt_ID | P63316 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | cIp-s |
|---|---|
| Peptide_Sequence | TQKIFDLRGKFKRPTLRRVR |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2516.04 |
|---|---|
| Aliphatic_Index | 73.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 4.40000 |
| Charge_at_pH_7 | 6.99753 |
| Isoelectric_Point | 12.68998 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 33 |
| Number_of_Hydrogen_Bond_Donors | 42 |
| Topological_Polar_Surface_Area | 1115.84000 |
| X_logP_energy | -9.76805 |
Interaction Information
| Affinity | KD=31 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | 1OZS |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure and dynamics of the C-domain of human cardiac troponin C in complex with the inhibitory region of human cardiac troponin I. |
| Release_Year | 2003 |
| PMID | 12732641 |
| DOI | 10.1074/jbc.M302497200 |