PPIRE02137
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK |
| Organism_Source | Escherichia virus CAM-21 |
| Functional_Classification | Enzyme |
| Cellular_Localization | Extracellular |
| Gene_Names | dsbA |
| UniProt_ID | A0A9E8YSS7 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | EF-Tu switch I peptide |
|---|---|
| Peptide_Sequence | AFDQIDAPEE |
| Peptide_Length | 10 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1134.16 |
|---|---|
| Aliphatic_Index | 59.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -3.99757 |
| Isoelectric_Point | 3.29497 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 508.72000 |
| X_logP_energy | -4.45920 |
Interaction Information
| Affinity | KD=119 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4P3Y |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of the Acinetobacter baumannii dithiol oxidase DsbA bound to elongation factor EF-Tu reveals a novel protein interaction site. |
| Release_Year | 2014 |
| PMID | 24860094 |
| DOI | 10.1074/jbc.M114.571737 |