PPIRE02356
Target Protein Information
| Protein_Name | Glucose-induced degradation protein 4 homolog |
|---|---|
| Protein_Sequence | MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR |
| Organism_Source | Homo sapiens |
| Functional_Classification | Enzyme |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GID4 |
| UniProt_ID | Q8IVV7 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | None |
|---|---|
| Peptide_Sequence | PGMWKS |
| Peptide_Length | 6 |
| Peptide_SMILES | CSCC[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 704.84 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 0.99769 |
| Isoelectric_Point | 9.70000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 10 |
| Number_of_Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 256.87000 |
| X_logP_energy | -1.52320 |
Interaction Information
| Affinity | KD=13.5 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular basis of GID4-mediated recognition of degrons for the Pro/N-end rule pathway. |
| Release_Year | 2018 |
| PMID | 29632410 |
| DOI | 10.1038/s41589-018-0036-1 |