PPIRE02366
Target Protein Information
| Protein_Name | Histone chaperone ASF1B |
|---|---|
| Protein_Sequence | MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI |
| Organism_Source | Homo sapiens |
| Functional_Classification | Epigenetic regulator |
| Cellular_Localization | Nucleus |
| Gene_Names | ASF1B |
| UniProt_ID | Q9NVP2 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HIRA453-467 |
|---|---|
| Peptide_Sequence | RTADGRRRITPLCIA |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1699.01 |
|---|---|
| Aliphatic_Index | 91.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | 2.93644 |
| Isoelectric_Point | 12.02327 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 787.29000 |
| X_logP_energy | -9.27962 |
Interaction Information
| Affinity | KD=1.909 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2I32 |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. |
| Release_Year | 2006 |
| PMID | 16980972 |
| DOI | 10.1038/nsmb1147 |