PPIRE02385
Target Protein Information
| Protein_Name | Proliferating cell nuclear antigen |
|---|---|
| Protein_Sequence | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | other |
| Cellular_Localization | Nucleus |
| Gene_Names | PCNA |
| UniProt_ID | P12004 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p1550-77 |
|---|---|
| Peptide_Sequence | GNPVCVRPTPKWQKGIGEFFRLSPKDSE |
| Peptide_Length | 28 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)CN)C(C)C)C(C)C)[C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3173.64 |
|---|---|
| Aliphatic_Index | 48.57143 |
| Aromaticity | 0.10714 |
| Average_Rotatable_Bonds | 3.57143 |
| Charge_at_pH_7 | 1.93911 |
| Isoelectric_Point | 9.57822 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 43 |
| Number_of_Hydrogen_Bond_Donors | 44 |
| Topological_Polar_Surface_Area | 1290.28000 |
| X_logP_energy | -12.42556 |
Interaction Information
| Affinity | KD=5.56 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of p15(PAF)-PCNA complex and implications for clamp sliding during DNA replication and repair. |
| Release_Year | 2015 |
| PMID | 25762514 |
| DOI | 10.1038/ncomms7439 |