PPIRE02536
Target Protein Information
| Protein_Name | Placenta growth factor |
|---|---|
| Protein_Sequence | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
| Organism_Source | Homo sapiens |
| Functional_Classification | other |
| Cellular_Localization | Extracellular |
| Gene_Names | PGF |
| UniProt_ID | P49763 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 18 |
|---|---|
| Peptide_Sequence | FDVCLLPHCCLVQ |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)Cc1ccccc1)C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | C4<->C12;side chain cyclization;disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1489.83 |
|---|---|
| Aliphatic_Index | 134.61538 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 3.38462 |
| Charge_at_pH_7 | -1.09658 |
| Isoelectric_Point | 5.28520 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 512.80000 |
| X_logP_energy | -2.08950 |
Interaction Information
| Affinity | IC50=1 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Evolution of potent and stable placental-growth-factor-1-targeting CovX-bodies from phage display peptide discovery. |
| Release_Year | 2011 |
| PMID | 21280651 |
| DOI | 10.1021/jm101226k |