PPIRE02554
Target Protein Information
| Protein_Name | Renin |
|---|---|
| Protein_Sequence | MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR |
| Organism_Source | Homo sapiens |
| Functional_Classification | Enzyme |
| Cellular_Localization | Extracellular |
| Gene_Names | REN |
| UniProt_ID | P00797 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AHMOA-Val-Phe-OCH3 |
|---|---|
| Peptide_Sequence | XVF |
| Peptide_Length | 3 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CN)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | X1=5-amino-3-hydroxy-7-methyloctanoic acid |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | other |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 321.38 |
|---|---|
| Aliphatic_Index | 96.66667 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 2.66667 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 4 |
| Number_of_Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 121.52000 |
| X_logP_energy | -0.10200 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibition of renin by angiotensinogen peptide fragments containing the hydroxy amino acid residue 5-amino-3-hydroxy-7-methyloctanoic acid. |
| Release_Year | 1983 |
| PMID | 6352942 |
| DOI | 10.1021/jm00364a019 |