PPIRE02734
Target Protein Information
| Protein_Name | Envelope glycoprotein |
|---|---|
| Protein_Sequence | MACSTLPKSPKDKIDPRDLLIPLILFLSLKGARSAAPGSSPHQVYNITWEVTNGDRETVWAISGRLYVSGRDPGLTFGIRLRYQNLGPRVPIGPNPVLAD |
| Organism_Source | Myeloproliferative leukemia virus |
| Functional_Classification | Viral envelope proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | env |
| UniProt_ID | P40932 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 12p1 |
|---|---|
| Peptide_Sequence | RINNIPWSEAMM |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCSC)C(=O)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1461.72 |
|---|---|
| Aliphatic_Index | 73.33333 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.83333 |
| Charge_at_pH_7 | -0.00024 |
| Isoelectric_Point | 6.41015 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 596.03000 |
| X_logP_energy | -4.54923 |
Interaction Information
| Affinity | KD=3.65 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Mode of action for linear peptide inhibitors of HIV-1 gp120 interactions. |
| Release_Year | 2004 |
| PMID | 14967033 |
| DOI | 10.1021/bi035088i |