PPIRE02812
Target Protein Information
| Protein_Name | Proteasome subunit beta type-1 |
|---|---|
| Protein_Sequence | MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD |
| Organism_Source | Homo sapiens |
| Functional_Classification | Enzyme |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PSMB1 |
| UniProt_ID | P20618 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 1a |
|---|---|
| Peptide_Sequence | LLLX |
| Peptide_Length | 4 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(C)C)C(=O)NCC(=O)O |
| Chemical_Modification | X4=alpha-ketoamide |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | other |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 414.55 |
|---|---|
| Aliphatic_Index | 292.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.25000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 5 |
| Number_of_Hydrogen_Bond_Donors | 5 |
| Topological_Polar_Surface_Area | 150.62000 |
| X_logP_energy | 0.62240 |
Interaction Information
| Affinity | IC50=1.45 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and Biological Activity of Peptide Alpha-Ketoamide Derivatives as Proteasome Inhibitors. |
| Release_Year | 2019 |
| PMID | 31312413 |
| DOI | 10.1021/acsmedchemlett.9b00233 |