PPIRE02838
Target Protein Information
| Protein_Name | Melanocyte-stimulating hormone receptor |
|---|---|
| Protein_Sequence | MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW |
| Organism_Source | Mus musculus |
| Functional_Classification | Receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Mc1r |
| UniProt_ID | Q01727 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | DOTA-Lys(IBU)-GGNle-CycMSHhex |
|---|---|
| Peptide_Sequence | KGGXDHfRWK |
| Peptide_Length | 10 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)CNC(=O)CNC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | X4=norleucine; f7=D?Phe |
| Cyclization_Method | D5<->K10, main chain cyclization, amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1187.33 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.90000 |
| Charge_at_pH_7 | 2.08875 |
| Isoelectric_Point | 10.78905 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 520.93000 |
| X_logP_energy | -4.41583 |
Interaction Information
| Affinity | IC50=1.417 nM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Effect of Ibuprofen as an Albumin Binder on Melanoma-Targeting Properties of 177Lu-Labeled Ibuprofen-Conjugated Alpha-Melanocyte-Stimulating Hormone Peptides. |
| Release_Year | 2024 |
| PMID | 38973113 |
| DOI | 10.1021/acs.molpharmaceut.4c00369 |