PPIRE02875
Target Protein Information
| Protein_Name | NAD-dependent protein deacylase sirtuin-5, mitochondrial |
|---|---|
| Protein_Sequence | MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS |
| Organism_Source | Homo sapiens |
| Functional_Classification | Enzyme |
| Cellular_Localization | Mitochondrion |
| Gene_Names | SIRT5 |
| UniProt_ID | Q9NXA8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 1 |
|---|---|
| Peptide_Sequence | GVLXEYGV |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)CN)C(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | X4=3-benzylsuccinyl |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 792.89 |
|---|---|
| Aliphatic_Index | 121.25000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -1.00109 |
| Isoelectric_Point | 3.84998 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 324.55000 |
| X_logP_energy | -2.14270 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Potent and Selective Inhibitors of Human Sirtuin 5. |
| Release_Year | 2018 |
| PMID | 29494161 |
| DOI | 10.1021/acs.jmedchem.7b01648 |