PPIRE03043
Target Protein Information
| Protein_Name | Host translation inhibitor 5b |
|---|---|
| Protein_Sequence | MNNSKDNPFRGAIARKARIYLREGLDCVYFLNKAGQAEPCPACTSLVFQGKTCEEHIHNNNLLSWQAVKQLEKQTPQRQSLN |
| Organism_Source | Avian infectious bronchitis virus (strain Beaudette) |
| Functional_Classification | Enzyme |
| Cellular_Localization | Cytoplasm |
| Gene_Names | None |
| UniProt_ID | Q89786 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NQW(S-S) |
|---|---|
| Peptide_Sequence | ACFPWGNQWCGGK |
| Peptide_Length | 13 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CS)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | C2<->C10;side chain cyclization;disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1453.66 |
|---|---|
| Aliphatic_Index | 7.69231 |
| Aromaticity | 0.23077 |
| Average_Rotatable_Bonds | 3.15385 |
| Charge_at_pH_7 | 0.87374 |
| Isoelectric_Point | 8.22969 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 547.51000 |
| X_logP_energy | -4.54360 |
Interaction Information
| Affinity | KD=56 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of constrained peptides that bind to and preferentially inhibit the activity of the hepatitis C viral RNA-dependent RNA polymerase. |
| Release_Year | 2003 |
| PMID | 12951030 |
| DOI | 10.1016/S0042-6822(03)00313-1 |