PPIRE03124
Target Protein Information
| Protein_Name | Small ubiquitin-related modifier 1 |
|---|---|
| Protein_Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| Organism_Source | Homo sapiens |
| Functional_Classification | other |
| Cellular_Localization | Nucleus |
| Gene_Names | SUMO1 |
| UniProt_ID | P63165 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Daxx20-pS737/pS739 |
|---|---|
| Peptide_Sequence | EIIVLSDSD |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)CC)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O)C(C)C |
| Chemical_Modification | S6=phosphoserine; S8=phosphoserine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 990.08 |
|---|---|
| Aliphatic_Index | 162.22222 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -2.99935 |
| Isoelectric_Point | 3.38003 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 448.48000 |
| X_logP_energy | -4.13020 |
Interaction Information
| Affinity | KD=1.6 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2KQS |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and functional roles of Daxx SIM phosphorylation in SUMO paralog-selective binding and apoptosis modulation. |
| Release_Year | 2011 |
| PMID | 21474068 |
| DOI | 10.1016/j.molcel.2011.02.022 |