PPIRE03163
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MADRRIPGTAEENLQKSSGGVPGQNTGGQEARPNYHCQLCFLRSLGIDYLDASLRKKNKQRLKAIQQGRQPQYLL |
| Organism_Source | Equine infectious anemia virus (strain Wyoming) |
| Functional_Classification | Viral envelope proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | tat |
| UniProt_ID | P20920 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | d-Arg-lactam-d-Arg |
|---|---|
| Peptide_Sequence | rXr |
| Peptide_Length | 3 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)CNC(=O)[C@@H](N)CCCNC(=N)N)C(=O)O |
| Chemical_Modification | X2=heterocyclic moiety |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 387.44 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.33333 |
| Charge_at_pH_7 | 1.99798 |
| Isoelectric_Point | 12.50011 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 6 |
| Number_of_Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 245.32000 |
| X_logP_energy | -3.47416 |
Interaction Information
| Affinity | IC50=6.8 uM |
|---|---|
| Affinity_Assay | Laser induced liquid bead ion desorption |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding sites of the viral RNA element TAR and of TAR mutants for various peptide ligands, probed with LILBID: a new laser mass spectrometry. |
| Release_Year | 2008 |
| PMID | 18693035 |
| DOI | 10.1016/j.jasms.2008.07.001 |