PPIRE03183
Target Protein Information
| Protein_Name | Envelope glycoprotein |
|---|---|
| Protein_Sequence | MACSTLPKSPKDKIDPRDLLIPLILFLSLKGARSAAPGSSPHQVYNITWEVTNGDRETVWAISGRLYVSGRDPGLTFGIRLRYQNLGPRVPIGPNPVLAD |
| Organism_Source | Myeloproliferative leukemia virus |
| Functional_Classification | Viral envelope proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | env |
| UniProt_ID | P40932 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide B |
|---|---|
| Peptide_Sequence | PLGVAPTKAKRRVVQREKR |
| Peptide_Length | 19 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H]1CCCN1)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C)C(C)C)[C@@H](C)O)C(C)C |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2189.64 |
|---|---|
| Aliphatic_Index | 76.84211 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 5.99886 |
| Isoelectric_Point | 12.52419 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 30 |
| Number_of_Hydrogen_Bond_Donors | 37 |
| Topological_Polar_Surface_Area | 990.62000 |
| X_logP_energy | -10.30792 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Analysis of interaction between sulfated polysaccharides and HIV oligopeptides by surface plasmon resonance. |
| Release_Year | 2018 |
| PMID | 30521896 |
| DOI | 10.1016/j.ijbiomac.2018.12.010 |