PPIRE03207
Target Protein Information
| Protein_Name | C-C chemokine receptor type 5 |
|---|---|
| Protein_Sequence | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL |
| Organism_Source | Homo sapiens |
| Functional_Classification | receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CCR5 |
| UniProt_ID | P51681 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 4DV3-FITC |
|---|---|
| Peptide_Sequence | lgaswhrpdk |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | 1-10=D-amino acids |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1166.30 |
|---|---|
| Aliphatic_Index | 49.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 1.08904 |
| Isoelectric_Point | 9.69702 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 506.35000 |
| X_logP_energy | -4.48583 |
Interaction Information
| Affinity | IC50=4.32 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design and evaluation of a CXCR4 targeting peptide 4DV3 as an HIV entry inhibitor and a ligand for targeted drug delivery. |
| Release_Year | 2019 |
| PMID | 29894816 |
| DOI | 10.1016/j.ejpb.2018.06.004 |