PPIRE03398
Target Protein Information
| Protein_Name | Envelope glycoprotein |
|---|---|
| Protein_Sequence | MACSTLPKSPKDKIDPRDLLIPLILFLSLKGARSAAPGSSPHQVYNITWEVTNGDRETVWAISGRLYVSGRDPGLTFGIRLRYQNLGPRVPIGPNPVLAD |
| Organism_Source | Myeloproliferative leukemia virus |
| Functional_Classification | Viral envelope proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | env |
| UniProt_ID | P40932 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | |
|---|---|
| Peptide_Sequence | ESTRPM |
| Peptide_Length | 6 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)O)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 719.81 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -0.00024 |
| Isoelectric_Point | 6.41015 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 339.69000 |
| X_logP_energy | -4.41723 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Simplified methods for construction, assessment and rapid screening of peptide libraries in bacteriophage. |
| Release_Year | 1992 |
| PMID | 1404385 |
| DOI | 10.1016/0022-2836(92)90219-a |