PPIRE03423
Target Protein Information
| Protein_Name | Cathepsin B |
|---|---|
| Protein_Sequence | MWWSLIPLSCLLALTSAHDKPSSHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPNLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | Enzyme |
| Cellular_Localization | Lysosome |
| Gene_Names | Ctsb |
| UniProt_ID | P00787 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PB8 |
|---|---|
| Peptide_Sequence | SYLKKLCGTVLGGPKL |
| Peptide_Length | 16 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CO)[C@@H](C)O)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1677.08 |
|---|---|
| Aliphatic_Index | 115.62500 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 2.93427 |
| Isoelectric_Point | 10.13348 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 629.78000 |
| X_logP_energy | -4.45070 |
Interaction Information
| Affinity | Ki=4.6 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibition of cathepsin B by its propeptide: use of overlapping peptides to identify a critical segment. |
| Release_Year | 1996 |
| PMID | 8774851 |
| DOI | 10.1016/0014-5793(96)00822-8 |