PPIRE03471
Target Protein Information
| Protein_Name | Tumor necrosis factor |
|---|---|
| Protein_Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Organism_Source | Homo sapiens |
| Functional_Classification | Immune-related protein |
| Cellular_Localization | Extracellular |
| Gene_Names | TNF |
| UniProt_ID | P01375 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 86TNF |
|---|---|
| Peptide_Sequence | DYLAGFKAHGKKYR |
| Peptide_Length | 14 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1653.90 |
|---|---|
| Aliphatic_Index | 42.14286 |
| Aromaticity | 0.21429 |
| Average_Rotatable_Bonds | 3.92857 |
| Charge_at_pH_7 | 3.08675 |
| Isoelectric_Point | 10.32740 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 688.02000 |
| X_logP_energy | -4.72053 |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding of human tumor necrosis factor alpha to multimeric complementary peptides. |
| Release_Year | 1992 |
| PMID | 1605624 |
| DOI | 10.1016/0003-9861(92)90555-b |