PPIRE03483
Target Protein Information
| Protein_Name | Putative uncharacterized protein GSN-AS1 |
|---|---|
| Protein_Sequence | MTHPLPHDSHTSGAPPLVNKSRDLANGPPFFSPLQSLWEEFLHLLFMGTLLFYRIATKALRGKATLLKSHSKQPAQPGWEPGIRAPSPVPASSLQDHSRLTSLSRTGKEQRRTLSLIRKTSGTPTESTVATAAASTTEVPSRLPWAARAGFKRTTGVCIALPT |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Extracellular |
| Gene_Names | GSN-AS1 |
| UniProt_ID | Q9NRJ2 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | None |
|---|---|
| Peptide_Sequence | CFILDL |
| Peptide_Length | 6 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 722.90 |
|---|---|
| Aliphatic_Index | 195.00000 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -1.06354 |
| Isoelectric_Point | 3.74997 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 9 |
| Number_of_Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 246.12000 |
| X_logP_energy | 0.60780 |
Interaction Information
| Affinity | IC50=9.4 uM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Aggregation of gelsolin wild-type and G167K/R, N184K, and D187N/Y mutant peptides and inhibition. |
| Release_Year | 2021 |
| PMID | 33598831 |
| DOI | 10.1007/s11010-021-04085-6 |