PPIRE03541
Target Protein Information
| Protein_Name | H-2 class II histocompatibility antigen, A-Q beta chain |
|---|---|
| Protein_Sequence | MALQIPSLLLSAAVVVLMVLSSPRTEGGNSERHFVAQLKGECYFTNGTQRIRSVNRYIYNREEWVRFDSDVGEYRAVTELGRPDAEYWNSQPEILERTRAEVDTVCRHNYEGVETHTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQSESARSKMLSGIGGCVLGVIFLGLGLFIRHRSQKGPRGPPPAGLLQ |
| Organism_Source | Mus musculus |
| Functional_Classification | Immune-related protein |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-Ab1 |
| UniProt_ID | P06342 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MBP 42-54 |
|---|---|
| Peptide_Sequence | GRFFGGDRGAPKRG |
| Peptide_Length | 14 |
| Peptide_SMILES | C[C@H](NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1477.65 |
|---|---|
| Aliphatic_Index | 7.14286 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.42857 |
| Charge_at_pH_7 | 2.99813 |
| Isoelectric_Point | 12.22264 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 681.85000 |
| X_logP_energy | -8.73729 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Quantitative Analysis of Peptides from Myelin Basic Protein Binding to the MHC Class II Protein, I-Au, Which Confers Susceptibility to Experimental Allergic Encephalomyelitis |
| Release_Year | 1996 |
| PMID | |
| DOI | 10.1007/bf03401615 |