PPIRE03610
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | Immune-related protein |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1 |
| UniProt_ID | P01868 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | BNP?1?32 |
|---|---|
| Peptide_Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Peptide_Length | 32 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO)C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | C10<->C26;side chain cyclization;disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Other |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3466.08 |
|---|---|
| Aliphatic_Index | 54.68750 |
| Aromaticity | 0.03125 |
| Average_Rotatable_Bonds | 3.78125 |
| Charge_at_pH_7 | 5.96449 |
| Isoelectric_Point | 11.58025 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 53 |
| Number_of_Hydrogen_Bond_Donors | 58 |
| Topological_Polar_Surface_Area | 1512.74000 |
| X_logP_energy | -20.75102 |
Interaction Information
| Affinity | KD=0.32 nM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure and thermodynamic analysis of diagnostic mAb 106.3 complexed with BNP 5-13 (C10A). |
| Release_Year | 2009 |
| PMID | 19274732 |
| DOI | 10.1002/prot.22366 |