PPIRE03668
Target Protein Information
| Protein_Name | Envelope glycoprotein |
|---|---|
| Protein_Sequence | MACSTLPKSPKDKIDPRDLLIPLILFLSLKGARSAAPGSSPHQVYNITWEVTNGDRETVWAISGRLYVSGRDPGLTFGIRLRYQNLGPRVPIGPNPVLAD |
| Organism_Source | Myeloproliferative leukemia virus |
| Functional_Classification | Viral envelope proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | env |
| UniProt_ID | P40932 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HNG-105 |
|---|---|
| Peptide_Sequence | RINNIXWSEAMM |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)CC)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCSC)C(=O)O |
| Chemical_Modification | X6=4-phenyl-1H-1,2,3-triazol-1-yl pyrrolidine-2-carboxylic acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1421.65 |
|---|---|
| Aliphatic_Index | 73.33333 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.91667 |
| Charge_at_pH_7 | -0.00024 |
| Isoelectric_Point | 6.41015 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 604.82000 |
| X_logP_energy | -5.42403 |
Interaction Information
| Affinity | KD=70.5 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Introducing metallocene into a triazole peptide conjugate reduces its off-rate and enhances its affinity and antiviral potency for HIV-1 gp120. |
| Release_Year | 2008 |
| PMID | 18498083 |
| DOI | 10.1002/jmr.892 |