PPIRE03679
Target Protein Information
| Protein_Name | Apoptosis regulator Bcl-2 |
|---|---|
| Protein_Sequence | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Mitochondrion |
| Gene_Names | BCL2 |
| UniProt_ID | P10415 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Bid-BH3 peptide |
|---|---|
| Peptide_Sequence | QEDIIRNIARHLAQVGDSMDRSIPPG |
| Peptide_Length | 26 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CCC(N)=O)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)NCC(=O)O)[C@@H](C)CC)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2889.24 |
|---|---|
| Aliphatic_Index | 93.84615 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.69231 |
| Charge_at_pH_7 | -0.90800 |
| Isoelectric_Point | 5.57022 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 41 |
| Number_of_Hydrogen_Bond_Donors | 44 |
| Topological_Polar_Surface_Area | 1306.55000 |
| X_logP_energy | -15.09159 |
Interaction Information
| Affinity | KD=89 nM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Characterization of the stereochemical structures of 2H-thiazolo[3,2-a]pyrimidine compounds and their binding affinities for anti-apoptotic Bcl-2 family proteins. |
| Release_Year | 2021 |
| PMID | 23794243 |
| DOI | 10.1002/cmdc.201300159 |