PPIRE04068
Target Protein Information
| Protein_Name | 11-beta-hydroxysteroid dehydrogenase 1 |
|---|---|
| Protein_Sequence | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
| Organism_Source | Homo sapiens |
| Functional_Classification | hydroxysteroid dehydrogenases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | HSD11B1 |
| UniProt_ID | P28845 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 4d |
|---|---|
| Peptide_Sequence | Yp |
| Peptide_Length | 2 |
| Peptide_SMILES | N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | adamantyl amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 278.31 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.50000 |
| Average_Rotatable_Bonds | 2.00000 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 4 |
| Number_of_Hydrogen_Bond_Donors | 3 |
| Topological_Polar_Surface_Area | 103.86000 |
| X_logP_energy | 0.33760 |
Interaction Information
| Affinity | IC50=62 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design, synthesis, and biological evaluation of novel selective peptide inhibitors of 11Beta-hydroxysteroid dehydrogenase 1. |
| Release_Year | 2018 |
| PMID | 30245006 |
| DOI | 10.1016/j.bmc.2018.09.009 |