PPIRE04166
Target Protein Information
| Protein_Name | Tyrosine-protein phosphatase non-receptor type 1 |
|---|---|
| Protein_Sequence | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT |
| Organism_Source | Homo sapiens |
| Functional_Classification | protein tyrosine phosphatases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PTPN1 |
| UniProt_ID | P18031 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Phe-Phe-Asp |
|---|---|
| Peptide_Sequence | FFD |
| Peptide_Length | 3 |
| Peptide_SMILES | N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 427.46 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.66667 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 5 |
| Number_of_Hydrogen_Bond_Donors | 5 |
| Topological_Polar_Surface_Area | 158.82000 |
| X_logP_energy | 0.32800 |
Interaction Information
| Affinity | IC50=104.2 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis of small peptide compounds, molecular docking, and inhibitory activity evaluation against phosphatases PTP1B and SHP2. |
| Release_Year | 2018 |
| PMID | 30584278 |
| DOI | 10.2147/DDDT.S186614 |