PPIRE04183
Target Protein Information
| Protein_Name | Tyr recombinase domain-containing protein |
|---|---|
| Protein_Sequence | MAKFIKASSIPSYLSGVVFCLCPLYPEITHIRHDDHIRLVLRGLLRQHGSNINCKQPISFTDLDKLFTTYPHKSYDNQLFLTMLTVGFFGLLRLGELADSNDVRLINRCKTIQHKSLYFTASSAGFILPASKTDRFFAGNKVIVKSNHHHNDPVQAVRLYVNQHDQPFPNLPWLWLTSQGIPPTRSWFLNCFHLHFDTRYRGHSMRAGGATLLAQHGVPFHVIQAIGRWSSETFLIYIRTHPSLLIPAT |
| Organism_Source | Agaricus bisporus var. burnettii |
| Functional_Classification | polyphenol oxidase |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | A0A8H7C4C8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FPY |
|---|---|
| Peptide_Sequence | FPY |
| Peptide_Length | 3 |
| Peptide_SMILES | N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 425.48 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.66667 |
| Average_Rotatable_Bonds | 2.66667 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 5 |
| Number_of_Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 132.96000 |
| X_logP_energy | 1.06510 |
Interaction Information
| Affinity | IC50=1.11 mM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | 2Y9X |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Separation, identification, and molecular docking of tyrosinase inhibitory peptides from the hydrolysates of defatted walnut (Juglans regia L.)meal. |
| Release_Year | 2021 |
| PMID | 33730668 |
| DOI | 10.1016/j.foodchem.2021.129471 |