PPIRE04316
Target Protein Information
| Protein_Name | Periplasmic oligopeptide-binding protein OppA |
|---|---|
| Protein_Sequence | MTNITKRSLVAAGVLAALMAGNVALAADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH |
| Organism_Source | Escherichia coli (strain K12) |
| Functional_Classification | ATP-binding cassette (ABC) transporter substrate-binding protein (SBP) |
| Cellular_Localization | Extracellular |
| Gene_Names | oppA |
| UniProt_ID | P23843 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | KPK |
|---|---|
| Peptide_Sequence | KPK |
| Peptide_Length | 3 |
| Peptide_SMILES | NCCCC[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCCN)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 371.48 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 1.99739 |
| Isoelectric_Point | 10.80538 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 6 |
| Number_of_Hydrogen_Bond_Donors | 5 |
| Topological_Polar_Surface_Area | 164.77000 |
| X_logP_energy | -0.86790 |
Interaction Information
| Affinity | KD=5200 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 1B46 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystallographic and calorimetric analysis of peptide binding to OppA protein. |
| Release_Year | 1999 |
| PMID | 10438628 |
| DOI | 10.1006/jmbi.1999.2929 |