PPIRE04330
Target Protein Information
| Protein_Name | Periplasmic oligopeptide-binding protein OppA |
|---|---|
| Protein_Sequence | MTNITKRSLVAAGVLAALMAGNVALAADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH |
| Organism_Source | Escherichia coli (strain K12) |
| Functional_Classification | periplasmic binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | oppA |
| UniProt_ID | P23843 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Lys-Dab-Lys |
|---|---|
| Peptide_Sequence | KXK |
| Peptide_Length | 3 |
| Peptide_SMILES | NCCCC[C@H](NC(=O)CNC(=O)[C@@H](N)CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 331.42 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.33333 |
| Charge_at_pH_7 | 1.99739 |
| Isoelectric_Point | 10.80538 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 6 |
| Number_of_Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 173.56000 |
| X_logP_energy | -1.74270 |
Interaction Information
| Affinity | KD=3.6 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 1B4H |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes. |
| Release_Year | 1999 |
| PMID | 10422831 |
| DOI | 10.1110/ps.8.7.1432 |